PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676786096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family EIL
Protein Properties Length: 556aa    MW: 63501 Da    PI: 6.1032
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676786096genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3352.67.8e-108454111353
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                eel+k+ wk +++lk++ke++k+ l+++    +     +  e+++++ m +aQDgiLkYM k  e c+a+GfvYgi+ e+gk+ +g+ d Lr+WWk+kv+
  676786096  45 EELEKKIWKYKQRLKHVKEMSKSGLGTRLF-NQRDDCPELPEHSSKRMMYQAQDGILKYMSKVTERCKAKGFVYGIVFENGKTLTGSTDTLREWWKDKVR 143
                8***********************999988.5555667999*********************************************************** PP

                XXXXXXXXXXXXXXX.XXXXXXXXXX.....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--...---- CS
       EIN3 101 fdrngpaaiskyqak.nlilsgessl.qtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqg..tppyk 196
                fdrngpaai k+q + n    ++s+l    + s+ h+l elqDTtlg+LLsalm  c+ppqrr+ple+gv+pPWWPtGke+ww+ l+l++d +  +ppyk
  676786096 144 FDRNGPAAILKHQREiNPTTYEGSDLgYEVGDSTAHKLLELQDTTLGALLSALMPNCKPPQRRYPLERGVTPPWWPTGKEDWWEDLSLPEDCRglPPPYK 243
                ************55413444444554344599******************************************************************** PP

                -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX....XX......XXXXXXXXXXXXXXXXXXXX. CS
       EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah....ss......slrkqspkvtlsceqkedve. 285
                kphdlkk+wkv+vL a i+hm+ +i++i +l+r+s++lq+km+++e   +l+ l++e++++ +  +h    s+        +++++++ + +++++dv+ 
  676786096 244 KPHDLKKMWKVGVLIAIIRHMASEINNIPKLVRRSRSLQEKMTSREGSLWLAALSREKAIIGQSPQHplafSPednsfvPGTDGETEFLFPESADYDVDp 343
                ***********************************************************999988886554227786665556999*************8 PP

                ..XXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
       EIN3 286 ..gkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                  g +++   h+ +    ++f+    +++ +++  +     ++ tcq+  +++s+++++f+d+ s+++++
  676786096 344 ayGSHHRLSPHIPEFG--NNFNSGYNKRRFEGDLGMSLHPTTIFTCQNIPCPYSQPQMGFHDRVSRENHQ 411
                8766666645555544..5999998888888888888888899*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.3E-10645301No hitNo description
Gene3DG3DSA:1.10.3180.102.6E-59174306IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.26E-52178303IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MYNNSTGIFR GLLSNQAPRF PDGDASSASL NAMCDDLSEE EMEIEELEKK IWKYKQRLKH  60
VKEMSKSGLG TRLFNQRDDC PELPEHSSKR MMYQAQDGIL KYMSKVTERC KAKGFVYGIV  120
FENGKTLTGS TDTLREWWKD KVRFDRNGPA AILKHQREIN PTTYEGSDLG YEVGDSTAHK  180
LLELQDTTLG ALLSALMPNC KPPQRRYPLE RGVTPPWWPT GKEDWWEDLS LPEDCRGLPP  240
PYKKPHDLKK MWKVGVLIAI IRHMASEINN IPKLVRRSRS LQEKMTSREG SLWLAALSRE  300
KAIIGQSPQH PLAFSPEDNS FVPGTDGETE FLFPESADYD VDPAYGSHHR LSPHIPEFGN  360
NFNSGYNKRR FEGDLGMSLH PTTIFTCQNI PCPYSQPQMG FHDRVSRENH QATCPYKATP  420
YYQATRPFGM PPGLVAPYPG YYSWSYQGKQ PVDQVEMQQQ QQHMQSFQDQ FSPSNNLYRP  480
KAAERGGTSG YLSHNRFNLD DDSSPSTSVM NHSPGLVVPT DFNGDAESER MENNQENQEE  540
NNQQNQEENL PMPWIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-501763031126Protein ETHYLENE INSENSITIVE 3
4zds_B1e-501763031126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400682.10.0hypothetical protein EUTSA_v10013166mg
SwissprotO231150.0EIL2_ARATH; ETHYLENE INSENSITIVE 3-like 2 protein
TrEMBLV4KVW70.0V4KVW7_EUTSA; Uncharacterized protein
STRINGAT5G21120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147191621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G21120.10.0ETHYLENE-INSENSITIVE3-like 2